KChIP2/KCNIP2 Antibody orb315160 from Biorbyt

Product Specs
ItemKChIP2/KCNIP2 Antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb315160
Quantity10 µg, 100 µg
ApplicationsFC, ICC, IF, IHC, WB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Mouse, Rat
TargetKChIP2/KCNIP2
IsotypeRabbit IgG
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid
NCBI Full Gene Namepotassium voltage-gated channel interacting protein 2
NCBI Gene AliasesKCHIP2
ClonalityPolyclonal
Molecular Weight30907 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Western blot, 0.1-0.5µg/ml, Human, Mouse, RatImmunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2µg/ml, Human Flow Cytometry, 1-3µg/1x106 cells, Human

Add to Compare List